Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 12(PCR12)
Volume: 50 ug. Other sizes are also available. Please Inquire.
Product Type: Recombinant Protein
Species: Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.: Q9SX26
Tag Info: The tag type will be determined during production process.
Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein
Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence: MYGNGPVFKAEGTSFRDQPYAEQLPQGLWTTGLCDCHEDAHICVQTAIMPCVSFAQNVEI VNRGTIPCMNAGLIHLALGFIGCSWLYAFPNRSRLREHFALPEEPCRDFLVHLFCTPCAI CQESRELKNRGADPSIGWLSNVEKWSREKVTPPIVVPGMIR
Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 12 Short name= AtPCR12
Gene Names: Name: PCR12 Ordered Locus Names: At1g68630 ORF Names: F24J5.13
Expression Region: 1-161
Sequence Info: full length protein
This content will be shared across all product pages.
Internal Reference:
CSB-CF890464DOA
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.