Skip to Content

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 4(PCR4)

https://www.1-800-oncologist.com/web/image/product.template/117044/image_1920?unique=59ef7fb
(0 review)
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q9LS44 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MGRPGSQPNEAQPPPVQVQPTVNRDNQVHSQNGAIGQANIQTGRPVNNQTQNLWSSDLFD CMNDSENAVITCLAPCVTLGQIAEIVDEGATPCATGGLLYGMIFFIGVPFVYSCMFRAKM RNKYGLPDAPAPDWITHLFCEHCALCQEYRELKHRGFDPNIGWAGNVQAQQPVMSPPTGQ RMMG Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 4 Short name= AtPCR4 Gene Names: Name: PCR4 Ordered Locus Names: At3g18460 ORF Names: MYF24.18 Expression Region: 1-184 Sequence Info: full length protein

1,100.88 1100.88 USD 1,100.88 Tax Excluded

1,100.88 Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF864825DOA

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.