Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10(PCR10)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.: Q8S8T8 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MKEKKGHYVPPSYIPLTQSDADTEVETTTPNLEIAVSESTKDDPRQWSSGICACFDDMQS CCVGLFCPCYIFGKNAELLGSGTFAGPCLTHCISWALVNTICCFATNGALLGLPGCFVSC YACGYRKSLRAKYNLQEAPCGDFVTHFFCHLCAICQEYREIREQSSGSYPLDMKMAITNA PLAQTMESAN Protein Names: Recommended name: Protein PLANT CADMIUM RESISTANCE 10 Short name= AtPCR10 Gene Names: Name: PCR10 Ordered Locus Names: At2g40935 ORF Names: T20B5 Expression Region: 1-190 Sequence Info: full length protein