Recombinant Human Olfactory receptor 1J2(OR1J2)

Volume: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Homo sapiens (Human) Uniprot NO.: Q8NGS2 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MSPENQSSVSEFLLLGLPIRPEQQAVFFTLFLGMYLTTVLGNLLIMLLIQLDSHLHTPMY FFLSHLALTDISFSSVTVPKMLMDMRTKYKSILYEECISQMYFFIFFTDLDSFLITSMAY DRYVAICHPLHYTVIMREELCVFLVAVSWILSCASSLSHTLLLTRLSFCAANTIPHVFCD LAALLKLSCSDIFLNELVMFTVGVVVITLPFMCILVSYGYIGATILRVPSTKGIHKALST CGSHLSVVSLYYGSIFGQYLFPTVSSSIDKDVIVALMYTVVTPMLNPFIYSLRNRDMKEA LGKLFSRATFFSW Protein Names: Recommended name: Olfactory receptor 1J2 Alternative name(s): HSA5 HTPCRX15 OST044 Olfactory receptor 1J3 Olfactory receptor 1J5 Olfactory receptor OR9-19 Gene Names: Name: OR1J2 Synonyms: OR1J3, OR1J5 Expression Region: 1-313 Sequence Info: full length protein