Recombinant Rat Uncharacterized protein C4orf3 homolog

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Rattus norvegicus (Rat) Uniprot NO.: Q498U0 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MEVGQAASGTDGVRERRGSSAARRRSQDEPVQSGMNGIPKHSYWLDLWLFILFDLALFIF VYLLP Protein Names: Recommended name: Uncharacterized protein C4orf3 homolog Gene Names: Expression Region: 1-65 Sequence Info: full length protein