Recombinant Oltmannsiellopsis viridis ATP synthase subunit c, chloroplastic(atpH)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Oltmannsiellopsis viridis (Marine flagellate) Uniprot NO.: Q20EV7 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MNPLIAAASVVAAGLSVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFAS Protein Names: Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein Gene Names: Name: atpH Expression Region: 1-82 Sequence Info: full length protein