Recombinant Welwitschia mirabilis Photosystem II reaction center protein Z(psbZ)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Welwitschia mirabilis (Tree tumbo) (Welwitschia bainesii) Uniprot NO.: B2Y1U7 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MTIVFQLTMFALIAISFLLIIGVPITFASPDGWSSNKNIVFSGVSLWIVLVFAVGILNSF IS Protein Names: Recommended name: Photosystem II reaction center protein Z Short name= PSII-Z Gene Names: Name: psbZ Expression Region: 1-62 Sequence Info: full length protein