Recombinant Xenopus laevis UPF0542 protein C5orf43 homolog

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Xenopus laevis (African clawed frog) Uniprot NO.: A9JTJ0 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MIDTLKGWAEYLVEWAAKDPYGFLITVLLALTPLFLASAVLSWKMAKMIEAKERDQKKKQ KRQENIAKAKRTKKD Protein Names: Recommended name: UPF0542 protein C5orf43 homolog Gene Names: Expression Region: 1-75 Sequence Info: full length protein