Recombinant Escherichia coli Pilin(traA)

Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Escherichia coli (strain K12) Uniprot NO.: P04737 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: AGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVF IAVGMAVVGL Protein Names: Recommended name: Pilin Alternative name(s): F-pilin Gene Names: Name: traA Ordered Locus Names: ECOK12F074 Expression Region: 52-121 Sequence Info: full length protein