Skip to Content

Recombinant Uncharacterized protein Mb0644c (Mb0644c)

https://www.1-800-oncologist.com/web/image/product.template/114714/image_1920?unique=46f7a2e
(0 review)
Volume: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Mycobacterium bovis Uniprot NO.: P64730 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris-based buffer,50% glycerol, optimized for this protein Storage: Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence: MRIGVGVSTAPDVRRAAAEAAAHAREELAGGTPALAVLLGSRSHTDQAVDLLAAVQASVE PAALIGCVAQGIVAGRHELENEPAVAVWLASGPPAETFHLDFVRTGSGALITGYRFDRTA HDLHLLLPDPYSFPSNLLIEHLNTDLPGTTVVGGVVSGGRRRGDTRLFRDRDVLTSGLVG VRLPGAHSVSVVSQGCRPIGEPYIVTGADGAVITELGGRPPLHRLREIVLGMAPDEQELV SRGLQIGIVVDEHLAVPGQGDFLIRGLLGADPTTGAIGIGEVVEVGATVQFQVRDAAAAD KDLRLAVERAAAELPGPPVGGLLFTCNGRGRRMFGVTDHDASTIEDLLGGIPLAGFFAAG EIGPVAGHNALHGFTASMALFVD Protein Names: Recommended name: Uncharacterized protein Mb0644c Gene Names: Ordered Locus Names: Mb0644c Expression Region: 1-383 Sequence Info: full length protein

1,252.08 1252.08 USD 1,252.08 Tax Excluded

1,252.08 Tax Excluded

Not Available For Sale

This combination does not exist.

This content will be shared across all product pages.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF353173MVH